The Jesus Institute Forum

 

The Ultimate Choice, the Ultimate Quests and the Good News

by Robert Moon
Draft © March 15, 2005 




Forward

The Christian Bible speaks to the ultimate choice and ultimate quests common to most individuals and cultures. The ultimate choice that confronts every intelligent human is: “what value system will be the guide for my decisions?” Failure to consciously formulate a value system usually results in people finding ways to justify whatever they want to do, even when it is obviously detrimental to others.An old-fashioned word for this is selfishness.A more contemporary word is Narcissism. Extreme Narcissism has been identified in most, if not all, brutal dictators.Extreme Narcissism is a pathology, with clinically labels such as sociopath or psychopath.

The chosen value system contributes positively or negatively to the functioning of individuals and communities.Historical and archaeological evidence supports that the ultimate choice of a value system for individuals and societies is driven by three ultimate quests.These quests are:

·the Quest for Security

·the Quest for Identity

·the Quest for Assurance of Existence after Death (the Afterlife)

The Christian Bible and resulting belief systems have contributed both positively and negatively to the lives of individuals and communities.Whether the contribution is positive or negative is influenced by the interpretation given to Bible passages.Some interpretations of selected passages of Scripture have been used to support slavery while alternate interpretations contributed significantly to abolishing slavery.

The Bible has many multiple accounts of the same event where the different accounts give different perspectives.This is common when there are multiple witnesses of an event.However, some Christians promote that God illuminates witnesses to prevents such conflicts.An analysis of Scripture suggests this is a presumptive and unsubstantiated viewpoint about how God relates to Scripture.The Bible is not written with the precision of a mathematics or science textbook.Further, the languages used across multiple times-frames and cultures adds a variety of problems for interpreters.

Interpretation of scripture which demonize God and consequently drive some toward atheismwere recognized by Thomas Jefferson.At the beginning of a 1823 letter to John Adams, Thomas Jefferson states:


Dear Sir, — The wishes expressed, in your last favor, that I may continue in life and health until I become a Calvinist, at least in his exclamation of `mon Dieu! jusque à quand'! would make me immortal. I can never join Calvin in addressing his god. He was indeed an Atheist, which I can never be; or rather his religion was Dæmonism. If ever man worshipped a false god, he did. The being described in his 5. points is not the God whom you and I acknolege and adore, the Creator and benevolent governor of the world; but a dæmon of malignant spirit. It would be more pardonable to believe in no god at all, than to blaspheme him by the atrocious attributes of Calvin. Indeed I think that every Christian sect gives a great handle to Atheism by their general dogma that, without a revelation, there would not be sufficient proof of the being of a god. Now one sixth of mankind only are supposed to be Christians: the other five sixths then, who do not believe in the Jewish and Christian revelation, are without a knolege of the existance of a god!(Jefferson's letter to John Adams, from Monticello, April 11, 1823).
Karen Edmisten states in her lead article, Calvin's Contraception Contradiction, of September 2002 issue of This Rock that:

This brings us to Calvin's theory of double predestination, which teaches that God has predetermined who will be saved and who will be damned. If double predestination is true, there is no room for a genuinely free will as regards our actions and choices. Those who study Calvinist beliefs in an objective fashion might well ask, "If our fate is sealed, what difference do our actions make? Does it matter if we go to church, or evangelize, or follow the Commandments or ignore them? What difference does it make if we contracept? If we have no control over our actions, but are merely puppets performing the drama of God's grace, then don't our actions become meaningless?"

The most important criteria for choosing between alternate perspectives of events or doctrines is how do the “paradoxical propositions” (possibilities) relate to the synthesis of God’s character found in Scripture. Throughout Scripture the righteousness of God is expressed in terms of His Justice, Love and Mercy. As “paradoxical propositions” are examined it is proposed that the “tiebreaker” be how the alternate concepts relate to the hallmarks of God’s character, Justice, Love and Mercy. 

This “tiebreaker” is applied to a number of important “paradoxical propositions” where one option makes God the ultimate vindictive torturer and/or pathologically narcissistic.These negative doctrinal positions create images of God that are the antithesis of justice, love, and mercy. They have slandered God’s character and deterred many honest seekers from becoming part of Christian communities.

There are alternative interpretations to scripture to those which demonize God and make human choices, endeavors and activities as meaningless as those of puppets.The examination of “the Ultimate Choice, the Ultimate Quests and the Good Newswhich follows, provides positive alternatives which emphases the hallmarks of God’s character- His Justice, Love and Mercy. 


The Ultimate Choice, the Ultimate Quests and the Good News

by Robert Moon

Draft Copyright March 15, 2005

Making the Ultimate Choice

The ultimate choice that confronts every intelligent human is: “what value system will be the guide for my decisions?”This ultimate choice establishes a belief system paradigm that affects everything you do. Most important, it guides you on how you will relate to others, your community, and your country.Will you place your needs and desires in a balanced perspective with the needs of others?Or, will you approach life in a narcissistic manner where the only thing that counts is what you want regardless of how you get it? Every religion and philosophy addresses this choice. 

The ultimate choice of a value system for individuals and societies is driven by three ultimate quests.These quests are:

·the Quest for Security

·the Quest for Identity

·the Quest for Assurance of Existence after Death (the Afterlife)

Choice versus Determinism

Some argue that humans do not reality have the ability to choose.Rather, they are electrochemical machines responding to electrochemical stimuli.With such a model if everything could be known about a person, their genetics, their history, and their current state of being, it would theoretically be possible to predict how the person would respond to any situation (electrochemical stimuli).This type of model is a reasonable outcome of an evolutionary perspective.And in fact, B. F. Skinner and Carl Rogers held classical discussions on the issue as to whether or not humans had choice?

A deterministic model is not unique to evolutionary theory.Some Christian scholars and communities view nature and human choice in a deterministic manner. This was, in part, a result of how some Christian scholars interpreted what the Scripture says about God and His creation.The deterministic concepts of evolutionary and Christian scholars appear to have also been strongly influenced by the increasing ability of Renaissance scientists to use mathematics to make correct astronomical and physical predictions.

The ability to use mathematics, physics and astronomy to explain and make accurate predictions about nature also presented theological challenges that reshaped traditional approaches to epistemology.The long-standing practice where theologians interpreted Scripture to declare how nature worked was replaced by the scientific method.The conservative Christian community’s response the Copernican Conflict contributed to the paradigm shift, where in scholarly communities scientific exploration and process took precedence over theologians’ declarations about how nature worked.


While theologians have reconciled their thinking to accept scientific explanations about the position of earth related to the universe, the tension between science and religion exists in new areas.Most notably, positions of some Christian scholars and communities related to creationism versus evolution and the age of the earth.
As science advanced the optimism about scientific-mathematical predictability was challenged.A classical example of such a challenge to deterministic scientific thinking was the Heisenberg uncertainty principle.
Religious positions taken on determinism versus choice have significantly theological implications concerning: (1) the justice, love, and mercy of a Creator God versus His eternal torture sinners and, (2) the extent to which God’s messengers were influenced and/or limited by the context of their culture’s language and ideas.

What is the Uncaused-Cause

The ultimate question of origin is what is the uncaused-cause.Is there a “designer- creator” or are there only “evolutionary-processes?” 

Genetic adaptation to environmental circumstances can be observed.This is given as a rationale to support a more general evolutionary theory.However, the theory goes beyond what can be supported from scientific observation and experimentation.

Evolutionary theory does not account for: 

·The entire substance of the universe suddenly coming from a mathematical singularity which has no size nor mass (the Big Bang).

·There does not seem to have been enough time since the Big Bang to develop the chemical complexity needed for life.

·There is no rationale for having all the right ingredients needed for complex reactions in one place. 

Some would include a violation of the second law of thermodynamics in the above list.However, this seems redundant within the context of the Big Bang.

Those who believe in a Creator God have a simple answer for the above three items.God did it.God is the uncaused-cause.

The most abundant and diverse molecules found in living cells are proteins.Proteins are macromolecules composed of one or more polypeptide chains each having a characteristic sequence of amino acids linked by peptide bonds. Their molar mass is usually above 100,000. 

For the purposes of illustration concerning time and randomness a simple but important enzyme molecule Ribonuclease will be used, a nuclease that catalyzes the hydrolysis of specific phosphodiester linkages of RNA.Ribonuclease has 124 amino acid residues linked in a single chain. A residue is a single unit within a polymer, for example, an amino acid within a polypeptide chainThere are 20 different amino acids.Thus, this single chain has20124 possible arrangements (20124 = 2.12 x 10161). 

It is common to represent each amino acid by a different letter when illustrating their arrangement in a chain.An arrangement of Ribonuclease using this approach follows:


KETAAAKFERQHMDSSTSAASSSHYCNQMMKSRNLTKDRCKPVHTFVHESLADVQAVCSQKHVACKNGOTHCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

There are about 31,336,000 seconds in a year (60x60x24x365=31,336,000).Let’s suppose with some form of a super catalyst in an ideal amino acid soup it was possible to construct 1021 (an average more than 31 trillion arrangements per second) per year of the more than 2x10161 possible arrangements of the 124 amino acid residues. One lecturer noted the mass of this many alternatives would be more than the mass of our universe. To accomplish this it would take more than a trillion trillion trillion trillion trillion trillion trillion trillion trillion trillion trillion times as many years as the estimated age of the universe. ONE CELL MAY HAVE MORE THAN A THOUSAND ENZYMES of comparable of greater complexity. If there is a designer creator God than time is not an issue.

If first-life processes are only from random genetic mutations with survival of the fittest, thenevolutionary theory has failed too adequately addressed the issue of time.

The uncaused-cause issue has significant implications for selecting a value system.

·If there is only “evolutionary-process”, then ethical responsibility is to self.

·If there is a “designer-creator” then there is still ethical responsibility to self but ultimate responsibility is to divine authority.

Historical Insights to Selecting a Value System 

and Responding to the Ultimate Quests

Archaeological and other historical evidence indicates most human societies focused much of their energy and resources on the three ultimate quests: Security, Identity (including the attempt to understand origins), and Existence after Death.These quests were the concern of both political and religious leaders. 

Throughout history these quests resulted in processes (rituals, mystical rites, rules and secret knowledge) for appeasing or finding favor with the God(s) which were key to security, identity, and existence after death. Often the ruling-political classes worked hand-in-hand with the religious leaders.And, in some societies the religious and political leaders were the same individuals.Those who “understood” and performed the processes for appeasing and finding favor with the God(s) use their mystical relations with the God(s) to maintain a fearful control over the less knowledgeable members of society.Karl Marx cynically called such forms of religious control “the opiate of the people.” 

As societies became more sophisticated, the palaces and temples became the schools for training the special classes intended to be the future political and religious leaders.A secret and guarded curriculum of mystical control mechanisms was reserved for only the most elite. The secret-mystical knowledge was most controlling when it portrayed that Devine authority was bestowed to special individuals by the God(s).


The quest for a viable “God based value system” has a very flawed history. Most value systems developed before 1500 AD, had some form of Spirit, God(s), or ancestral mystic authority.Approaches to gain the favor of fickle and vindictive God(s), spirits or ancestors included: human sacrifices (of firstborn, virgins, or enemies)temple prostitutes, genocide of those who did not serve your God, eating with the dead, self-mutilation, pilgrimages, heroic acts, holy wars, torturing and killing heretics, creating great temples or monuments, secret knowledge and rituals, communicating with the dead, . . .
The quest for a viable “human-reason-based value system” has a very flawed history. The French experiment to make human reason the supreme basis ethical decisions resulted in the reign of terror.Nietzsche’s philosophy with its implied value systems of strength over weakness was used as an intellectual framework for Nazi German genocide of millions of Jews and other European peoples.Atheistic Communism with its idealistic goal of “each contributing according to their ability and each receiving according to their needs” resulted in even more millions of deaths during the narcissistic reign of Stalin.These approaches to human-reason-based value systems of government are an embarrassment to the secular humanists.
The failure of societies to institute lasting and compassionate approaches to governance was recognized by our founding fathers as more than an issue of human reason.They and others have recognized it as flawed human nature.

Power tends to corrupt, and absolute power corrupts absolutely. Great men are almost always bad men . . . There is no worse heresy than that the office sanctifies the holder of it.(Lord Acton (1834-1902) British historian. . .'. Letterto Bishop Mandell Creighton, 5 Apr 1887)

Exceptions to the Rules

Is there an exception to Karl Marx’s statement that “Religion is the Opiate of the People?”Karl Marx observation is made possible because of “gatekeepers.”In a religion gatekeepers have such titles as Priests, Witch Doctors, Shamans, Medicine Man, Mystics, Magician, etc.Such gatekeepers had special relations with God(s). They were go-between’s who could make a difference in this life and/or the afterlife.The ethics associated with a religion often justified the right of the ruling elite and the virtue of being satisfied with the status to which one had been destined via God(s).Collaboration for control between political rulers and religious gatekeepers has historically been the rule rather than the exception. Control mechanisms included religious induced fear combined with every variety of torture and death for heretics and/or political dissenters.

The atheisticpolitical systems which came after Karl Marx observations would have embarrassed him.The gatekeepers were now “party members.”Control mechanisms still included fear, torture or death for those who failed to speak, think or act “politically correctly.”In the 20th century more people were killed (about 169 million) via “domicide” (governmental political murder and/or genocide) then in previous recorded history (approximately 140 million). Wrong thoughts or genes were dangerous and often fatal.


There is one exception to the Karl Marx observation.This exception has no gatekeepers. Evangelical Protestant Christians believe the Bible teaches that every believer can approach God directly without an earthly intermediary.This is made possible by the necessary and sufficient atonement of Jesus the Messiah who sits on the right hand of God the Father.Such a religious belief system eliminates earthly gatekeepers and establishes a priesthood of all believers (1 Peter 2:5-9 and Revelation 1:6).
The victorious Messiah is a heavenly high priest who is an advocate for every believer (Hebrews 2:17 & 18, 4:14-16 and 7:22-24).The heavenly foundations of government revealed in Scripture are based upon a faithful God whose character demonstrates an infinite balance of love, mercy and justice.God has no favorites (Romans 2:11).The sovereign God or the universe does not desires that any should perish but wants all should come to repentance (2 Peter 3:9) and receive the free gift of eternal life made possible to any who by faith choose to accept His divine grace (John 3:16, Ephesians 2:8 & 9, Romans 3:21– 28).“If we confess our sins, he is faithful and just and will forgive us our sins and purify us from all unrighteousness” (1 John 1:9 NIV).“This is love: not that we loved God, but that he loved us and sent his Son as an atoning sacrifice for our sins” (1 John 4:9). 
In human government “the exception to rule” of governing by terror, fear and death are made possible when the selfish nature of humans is recognized and an appropriate a system of laws with checks and balances is established. The Magna Carta was designed to enable a ruler to use power and authority for just purposes while preventing unjust use. Those who developed the Constitution of the United Statesrecognized the dilemma of human nature and built an approach to govern with checks and balances.The systems had the executive branch, the legislative branch, and the judicial branch.Each had a role and each was to participate in the check-and-balance process designed to prevent absolute control of any individual or branch of government.History demonstrates that human nature cannot be trusted. 

Coping with Ethical and Scriptural Ambiguities

Human language has far less precision than most people recognize.This is why conversations are needed clarify ideas even for people sharing the same culture.Human language becomes ever less precise as people attempt to communicate ideas across different cultures.Still more ambiguity is added when ideas are from distant times and diverse cultures.How could an ancient writer describe to those living in his time scenes from a modern city, cars, airplanes, rockets, H?bombs, or a modern war?The languages used by Bible writers did not have words to describe such scenes. 

Even today, how would a primitive man from New Guinea who has never experienced civilization described the followingexperience?Someone who knows his language befriends him and convinces him to take a journey.The journey begins with a one day walk to a clearing; where, a helicopter takes the primitive man and his modern friend to a jetport.The primitive man is cleaned up and dressed so he will not scare people.Together he and his modern interpreter-friend and experience a commercial jet flight, a modern city, a spaceship ride, riding in an elevator to view Chicago from the top of the Sears Tower, modern warfare in Iraq, landing in a jet fighter on an aircraft carrier, parachuting from a plane, looking at our Milky Way through a telescope, scuba diving, traveling on a luxury liner through the Panama Canal, experiencing a variety of modern foods, walking on a glacier, speeding down the freeway only to be confronted with a modern traffic jam, . . . the list could go on and on.


The primitive man is returned by helicopter to the clearing from where he walks back to his village.No one knows where he has been. How could he tell them about his experiences?His community’s language does not have the words.His community does not have a context that enables him to communicate with any degree of accuracy.At best he could attempt to convey approximate images of his experiences. 
Human knowledge is the historically contingent product of linguistic and social practices of particular local communities of interpreters, with no assured “ ever– closer” relation to an independent ahistorical reality. Because human experience is linguistically prestructured,yet the various structures of language possess no demonstrable connection with an independent reality, the human mind can never claim access to any reality other than what is determined by its local form of life, language is a “cage” (Wittgenstein ) (Tarnas pp.399).
The ambiguity and lack of precision in human language make it very important to develop a criterion which will guide in the selection of alternative interpretations of ethical and spiritual concepts.

Scripture gives a picture of a holy, just, loving and merciful God, who communicates through Scripture as one means of leading corrupt and degenerate humans into a healing/redemptive relationship with Him.His desire is to help humans take every possible advantage of his “good news” plan for leading them into a more abundant life now, and for eternity. 

The Justice, Love, and Mercy Tie-Breaker

Proposed Criterion for Judging Ethical and Scriptural Ambiguities: how do alternate ethical or spiritual ideas relate to the hallmarks of the Creator God’s character, His Justice, Love, and Mercy?God’s Holiness is the synthesis of His character including His Justice, Love and Mercy. God’s Grace is an expression of His Justice, Love, and Mercy granted to those who have faith in Him. When using such a criterion three questions need to be asked about alternate ethical, doctrinal, or spiritual positions:

·How well does the concept fit the love dimension of God’s character?

·How well does the concept fit the mercy dimension of God’s character?

·How well does the concept fit the justice dimension of God’s character?

A case can be made from history that, even when people do not believe in God, an examination of ethical/moral positions based on Justice, Love, and Mercy provides excellent and balanced criteria for selecting the best alternatives. Based on this criteria Communism had a noble ethical philosophy but failed because of human nature.

A Hierarchy of Ethical/Moral Behavior Systems

A historical synthesis of human behavioral, religious and philosophic writings supports a three level conceptual hierarchy of individual and societal relations. The three levels are:

·treat others the way you would like to be treated (The Golden Rule)

·an eye for an eye and a tooth for a tooth (treat others the way they treat you)

·hurts someone in my clan and we will genocide your clan (extreme vengeance)


Jesus the Christ expressed “So in everything, do to others what you would have them do to you, for this sums up the Law and the Prophets (Matthew 7:12).”This highest level of ethical moral behavior, sometimes called the Golden rule, is also reflected in a portion of his sermon on the Mount found in Matthew 5: 41- 48. Another elaboration of this highest concept of ethical/moral behavior is found in Matthew 22:37-40
(37) Jesus said unto him, Thou shalt love the Lord thy God with all thy heart, and with all thy soul, and with all thy mind. (38) This is the first and great commandment. (39) And the second [is ] like unto it, Thou shalt love thy neighbour as thyself. (40)On these two commandments hang all the law and the prophets(Matthew 22:37-40 KJV).
The 10 Commandments contain further elaboration on God’s expectations about man’s love for Him (The first four commandments) and expectations concerning treating others the way you would like to be treated (last six commandments).Throughout the law “Tora” and the Prophets other elaborations are found.For example relative to sexual impurity, Leviticus chapters 18 and 20 are explicit about types of sexual impurity.Christ in His Sermon on the Mount, clarifies still further when He speaks of impure thoughts of lust also being sin (Matthew 5:27 and 28). 

For the sincere of heart, the Creator God of the Bible brings clarity about His expectations.This is a marked comparison to the ambiguity found in the god(s) and/or philosophies of other ethical systems. “God is a God of peace, not confusion. This is the way it should be in all of the congregations of the holy people!(1 Corinthians 14:33 ?? International English).” 

While at college I had a two-year independent study with Dr. Paul Quimby, a historian, who had lived for much of his life in the Orient.He had an experiential understanding of philosophy and world religions.It was my joy to explore various ethical systems with him.In the life and teachings of Jesus the Christ I found a life-sustaining ethical system where intelligent beings endowed withchoice could live together without self-destructing.It was the only approach I found that expected and promoted individuals making the most of their talents.Other approaches seem designed to maintain the position of a ruling elite while keeping those of lesser class in their place.For example the class systems of Hinduism, the “be content with your status in life” of Buddhism and the “privileged party member” class of atheistic communism or fascism.All ethical approaches seem flawed in comparison to what I found in the life and teachings of Jesus the Messiah which made possible the priesthood of all believers (1 Peter 2:5 & 9), a kingdom of priests (Revelation 1:6). 

Different Reports of the Same the Event

Some Christians ascribed a precision to the Bible that is difficult to support.Some go as far as suggesting verbal communication from God combined with almost perfect internal consistency.For the atheist, agnostic or sincere-seeker such positions are like paper tigers waiting to be blown over by the mildest breeze.


A challenge to modern Christian scholars is to provide a rationale that explains significantly different reports about the same event.For example, 2 Samuel 24.1 (RSV) states "Again the anger of the Lord was kindled against Israel, and he incited David against them, saying, "Go number Israel and Judah" while 1 Chron. 21.1 (RSV) states: Satan stood up against Israel, and incited David to number Israel.”IfA=B and B=C then A=C logic is used, then in this situation the conclusion is that “Lord = Satan.”A possible explanation is that the writer of the Samuel account was a proponent of an extreme monotheism which ascribed both good and evil to God versus the writer of the Chronicle account believing there is a good God and evil challenger. 
There are many cases in both the Old and New Testament where different writers seem to place a different spin on comparable events.There are apparent differences in the order of events in the Genesis 1 and Genesis 2 creation accounts.There are numerous same events reported by writers of I & II Chronicles versus writers I & II Kings or I & II Samuel.The reports of I & II Chronicles seem like they were written in the monarchy’s PR department while those in I & II Samuel or I & II Kings tend to be much more critical of the monarchy.The genealogies of Jesus in Matthew and Luke have dramatic differences. An extensive list can be made from the Gospels of what seemed to be multiple reports of the same event, where there is considerable difference in the descriptions.
Different witnesses of the same event having different perceptions of what happened is a common documented occurrence.The fact that this seems to have happened in the Bible might indicate that God is less directive about how multiple witness reports a same-event than previously thought.Consequently, there is less congruency of the descriptions than some scholars might wish.

A similar but a different situation is where a collection of passages is used to support one interpretation of the doctrine while a second collection of passages can be used to support an alternate interpretation of the doctrine.There seemed to be two reasonable approaches to such situations:

·Judge the alternate interpretations by the criteria of God’s character where the hallmarks are Justice, Love, and Mercy.

·Put the alternate interpretations on the shelf of unanswered questions so long as the lack of response does not slander God’s character in a way that is detrimental to honest seekers.

I have been asked at many times what I think about the nature of Jesus the Christ.This question about Christ nature has produced extreme controversy and even bloodshed among professed Christians.My first response is that I believe that His nature is adequate for him to: be my high priest, be the perfect atonement for my sins, do all that is necessary and sufficient for me to be justified by faith alone and have assurance of salvation. 

A Variation on Pascal’s Wager

Most people contemplate questions about human origin and rules for social behavior. With a majority of individuals the concept of God or gods becomes part of their consideration. Pascal did not think that the atheist or the believer would be convinced by his arguments concerning the existence or nonexistence of God.Instead, he proposed a “Wager Logic” to the curious and unconvinced.


I have a choice: either (1) I believe God exists or (2) I do not believe God exists.
(1) If I believe God exists, and God in fact does exist, then I will gain infinite happiness. However, if I believe God exists, and God in fact does not exist, then I will have no payoff.
(2) If I do not believe God exists, and God does exist, then I will have infinite pain. However, If I believe God does not exist, and God does not exist, then I will have no payoff.

Thus, I have everything to gain and nothing to lose by believing in God, and I have everything to lose and nothing to gain by not believing in God. On these grounds, one would be foolish not to believe.

A problem some have with Pascal’s Wager is his belief that if God exists and I do not believe, the results will be the eternal pain of Hell.Pascal likely came to this position because he was part of the Catholic community that believed in eternal Hell. This makes his “God concept” that of an eternal torturer. This seems inconsistent with the life and teachings of a loving Christ although some would argue otherwise. 

Philosophers struggles with epistemology and ontology have resulted in various schools of philosophy. Some philosophers concluded that a “formal” proof that God exists or does not exist is beyond the human capability. Those who take this position are still left with questions of an axiology, “what is the benefit or what is the value of God(s) versus no God(s)?” Questions about the value of God(s) versus no God(s) immediately lead to consideration of what type of God(s).A study of this question may also lead to understandings that help with “God questions” which relate to epistemology and ontology. 

When I was in college, the question I considered was: "if God is like this what is the implication?" This led to a variation of Pascal's Wager.With Pascal's Wager the alternatives are: if God exists: eternal joyful existence for those who accept God's offers and respond appropriately versus eternal torture for those who deny God's existence (if he really exists). The eternal torture alternative of Pascal's concept of God is difficult for many to accept.An issue important to thoughtful seekers who contemplate the possibility of a relation with a supreme being is “what is God like?”.

A disciple asked Jesus to “SHOW us the FATHER.”This question and His profound reply as found in John 14:8-10 KJV translation follows.

(8) Philip saith unto him, Lord, SHOW us the FATHER, and it sufficeth us.(9) Jesus saith unto him, Have I been so long time with you, and yet hast thou not known me, Philip?He that hath seen me hath seen the FATHER; and how sayest thou [then ], SHOW us the FATHER? (10) Believest thou not that I am in the FATHER, and the Father in me? the words that I speak unto you I speak not of myself: but the FATHER that dwelleth in me, he doeth the works.


When in college I developed a variation of Pascal's Wager that I latter found was similar what others had developed.My variation was a result of my multi year study with Dr. Quimby where I considered various philosophies, religions and concepts of God(s).It allowed me to say “God if you're like this come into my life and make a difference, show me!”The concepts of God that allowed me to make this invitation were, in part, came from John 14: 7-10 and subsequent study of the life and teachings of Jesus.I found hope in the relationships revealed in this study and was happy to invite such a God into my life.One set of alternatives for inviting such a God into your life is as follows:
9.If the God reflective in the life and teachings of Christ exists and I invite him to be part of my life, He will make my life more meaningful now.He will also lead me into a path where I eventually have an eternal joyful existence with a loving God and safe loving intelligent beings.

1.If God does not exist I believe that the expectations for relationship and responsibility found in the life and teachings of Christ are superior to others I have studied and will help me have a more meaningful life now. It is a great placebo if nothing else.

10.If God exists and I chose not to invite him to be part of my experience, my perception of the teachings of Christ are that my eventual outcome will be eternal destruction not eternal torture.

Some concepts about God(s) have been and are now used to get “believers” to intimidate, coerce, torture, and/or kill others who do not believe or act “correctly.”This is detestable! The God who is part of my experience (real or imagined) is not like that. I have never regretted my decision to make the invitation to the God reflected in the life and teachings of Jesus to become part of my experience. 

A beginning to the important God quest is the third question of Table 1 (which follows) where generic questions of philosophy are applied to the examination of the God concepts.


 
Table 1.Philosophy and the Considerations about God
Area of Philosophy
General Question
God Specific Question
Epistemology
1. How Can we Know?
G1. How can we know if God exists? 
Ontology (Metaphysics)
2. What is Real?
G2. Is God Real?
Axiology
3. What is of Value?
G3.What is the Value if “A GOD LIKE THIS” ?

To consider question G3, it is essential to define “A GOD LIKE THIS.” Different definitions for “A GOD LIKE THIS” will result in different answers to G3.

I have had the pleasure of being friends with a number of compassionate skeptical seekers.Some became part of a Christian community when they discovered that not all Christians viewed God in the same way. For example, an eternal torturer who deliberately creates people destined to eternal torture and others destined to eternal heavenly joy.

God - Eternal Torturer or Eternal Destroyer


Could a God whose hallmarks of character include Justice, Love, and Mercy torture sinners in Hell forever?The belief that God is an eternal torturer creates tremendous cognitive dissonance in the lives of many Christians. This belief also deters many sincere people from seriously considering Christianity and its God.
Most civilized people would be outraged with a government which took even the vilest of criminals and subjected them to the excruciating torture year after year, while taking care not to kill them.This would be considered unjust even for Hitler and Stalin who were responsible for the deaths of tens of millions. How could a “just, Loving, and Merciful,” God torture people for an infinity of time?Many of the sinners would not have even committed what society considers a serious crime.What sort of love mercy and justice is this?
Chaplains at the Adventist Information Ministry (a Christian phone answering service located on the campus of Andrews University, Berrien Springs, Michigan 49104) continually interact with sincere people who are overjoyed to discover that some Christians believe the Bible teaches that God will destroy sinners rather than torturing them in Hell forever. It’s as though a burden has rolled off their back. This doctrine sometimes referred to “annihilationism” is being accepted by more and more Christians.

There are some “closet annihilationists.”A number of years ago at a convention, I atewith a Christian gentleman who belonged to a denomination that believed in eternal Hell.We enjoyed sharing our common beliefs.I told a story of parents who brutally punish their children for a minor infraction of a rule.He said “I think I know where you’re coming from, please go ahead.”I then asked him how he reconciled God being “just, loving and merciful” if He also tortured sinners in Hell for eternity, regardless of what they did in this flash of time we call life. He smiled and said “I have come to believe as you believe but it’s a little difficult to teach that in a seminary.”

Two references in the bibliography set forth for the position of annihilationism and a mortal soul in a manner that many would consider more reasonable than the traditional arguments used to support an eternal Hell (Fudge 1982 and West 2004).Appendix A has representative Scripture used by proponents of these alternate doctrinal positions.

The doctrine of Hell and eternal torture versus annihilation meet the conditions for the proposed “tiebreaker”: how do the alternate positions relate to the hallmarks of God’s character, Justice, Love, and Mercy? In the case of the annihilationism versus eternal torture in Hell the answer seems obvious.Eternal torture in Hell, regardless of what was done in someone’s lifetime, IS NOT just, loving, or merciful.

God -Puppeteer or Lover?

During my teens and early 20s I had opportunities that helped me grapple with thequestion: what value system will be the guide for my decisions?These opportunities included: (1) living near Stanford University where I had access to libraries and bookstores, (2) hiking in the Sierra where I interacted with wonderful atheists and agnostics about epistemology, origins, naturalism, and dealing with difficult and unanswered questions; and (3) a multi year study with a wonderful historian, Dr. Paul Quimby, who had spent the majority of his life in the Orient. This environment gave me a great opportunity to examine many challenging questions about the teachings of various religions and philosophies.


The question “what type of God” became paramount as I considered the plausibility of God versus no God.I examined Bible passages about science and prophecies to see if these provided a reason for believing the Bible was more than just a collection of human writings. While this study was interesting, it was the life and teachings of Jesus combined with a realistic assessment of human nature that were the most convincing.
The horrible acts committed by people appeared to have no solution based on human effort alone. The life and teachings of Jesus pointed to an alternative. The just, loving and merciful Creator-God offered a free redemptive/healing solution to do for humans what they could not do for themselves.It seemed like a great offer.Why not try it? This led to my response described earlier as a variation of Pascal’s wager.I have since discovered a number of my scientist friends went through a similar reasoning process.
The bottom-line is “what kind of God?”Is there a real God who has an infinitely Just, Merciful and Loving character?Doctrinal positions taken by some Christian communities are hard to reconcile with Justice, Love and Mercy. These include:

1.The Just, Merciful, and Loving Creator-God will torture beings in Hell forever, for their evil deeds committed in this flash of time we call a “lifetime.” This issue was discussed in the previous section with the response that a plausible interpretation of the Bible is that God will permanently destroy but not eternally torture sinners.

2.The Creator-God COULD BE Just, Merciful, and Loving while holding everyone accountable but not giving everyone an opportunity to respond to his redemptive salvation offer! 

3.The “Just, Merciful, and Loving” Creator-God creates some beings predestined to eternal torture in Hell and others predestined to eternal joy and happiness in heaven.Somehow this brings glory to Him and demonstrated that He is the Divine Righteous Sovereign of the universe!This concept seems to describe a Diabolical Puppeteer rather then the “Just, Loving, and Merciful,” Creator-God. 

Paul appears to recognize second Issue, a need for all to have opportunity, in Romans where he states “How, then, can they call on the one they have not believed in? And how can they believe in the one of whom they have not heard? And how can they hear without someone preaching to them? (Romans 10:14 NIV).”Paul responds to his rhetorical question by quoting part of Isaiah 52:7.”And how can they preach unless they are sent? As it is written," How beautiful are the feet of those who bring good news! (Romans 10:15 NIV).”The complete NIV translation of Isaiah 52:7 states “How beautiful on the mountains are the feet of those who bring good news, who proclaim peace, who bring good tidings, who proclaim salvation, who say to Zion, " Your God reigns! .””

If a contemporary Christian scholar generalized the application of Isaiah 52:7 as Paul appears to have done in Romans 10:14 and 15 they would likely be challenged for going beyond the contextual meaning of the passage. Peter might say some things Paul writes are difficult to understand, “. . . His letters contain some things that are hard to understand, which ignorant and unstable people distort, as they do the other Scriptures, to their own destruction ( 2 Peter 3:16 last part, NIV). 


Paul in Romans 2:11-16 more adequatelyharmonizes God’s Justice, Love and Mercy with stating how all sinners to have opportunities to make choices that lead to salvation. In Romans 2:11NIV Paul declares that “For God does not show favoritism.”He appears to build upon the concept of Romans 1:18-20 that all are without excuse because of what is revealed in God’s creation.Romans 2:14-16 supports that even Gentiles who do not have the Torah are without excuse because they have opportunity, the law is written in their hearts. 
Romans 2:14-16 NIV (14) ( Indeed, when Gentiles, who do not have the law, do by nature things required by the law, they are a law for themselves, even though they do not have the law, (15) since they show that the requirements of the law are written on their hearts, their consciences also bearing witness, and their thoughts now accusing, now even defending them. (16) This will take place on the day when God will judge men's secrets through Jesus Christ, as my gospel declares
Justice, Mercy and Love demand that there must be opportunity for somebody to be without excuse. If opportunity does not require some knowledge of the life and teachings of Jesus, it would be considered a form of “Religious Inclusivism.” “True opportunity” for salivation must make it possible for people to make choices which allow God to declare them righteous through the perfect atonement of Jesus the Christ.

Some argue that salvation requiresknowledge of Jesus’s life and teachings, “Christian exclusivism” or “particularism”(Samples 2004). (11) He is "'the stone you builders rejected, which has become the capstone. (12)'Salvation is found in no one else, for there is no other name under heaven given to men by which we must be saved"(Acts 4:11 & 12 NIV).An alternate interpretation of this passage is that the acts of Jesus the Christ makes salvation possible rather than knowing about the acts and/or a right “codename.” This alternate interpretation allows some to be saved without knowing about Jesus the Christ. Some might label this “Religious Inclusivism” (Samples 2004). Gravity works even if languages have no words to label it and science is unable to adequately explain it. 

God’s ways of accomplishing his Righteous acts of Justice, Love, and Mercy are sometimes beyond our conception.

Isaiah 55:8 (NIV)_(8) "For my thoughts are not your thoughts, neither are your ways my ways, " declares the Lord. (9) " As the heavens are higher than the earth, so are my ways higher than your ways and my thoughts than your thoughts. 

Dr. Quimby and I often explored ideas outside-the-box of traditional thinking because we recognized that God sometimes accomplishes things in unusual ways. The description of near-death experience where a person’s lifetime seems to rapidly unfold, motivated us to consider an outside-the-box idea.Our idea was God could use the episode of dying for the person to experience any knowledge or opportunity that might help him or her accept salvation.The opportunities and their responses could seem real. Today this might be called virtual-reality. Does the God who uses vision to bring spiritual understanding;also, use near-death virtual-reality experiences?If God does sometimes works this way, it makes “Christian exclusivism” versus “Religious Inclusivism”a mute Issue.

Perfect knowledge is not a prerequisite to conviction.Despite imperfect knowledge I believe in a personal holy Creator God who is true to His character hallmarked by Justice, Love, and Mercy.If “perfecttruth” is needed for salvation then at most, one can be saved for no two people agree on every point of doctrine.Demanding too much from “knowing,” can be a form of Gnosticism.


How would a sovereign dictator be judged if he instituted a program for separating children of conquered peoples into two groups where: most are tortured and treated in the most despicable ways; while, a small select group is given the best the dictator’s government can offer but forced to watch what was happening to their former friends and companions while being indoctrinated about the love mercy and justice of their benevolent dictator?Most rational people would consider the dictator a demonic tyrant.
Does the Just, Loving, and Merciful Creator God predestine some to eternal torture in Hell and others to eternal happiness in Heaven?Some Christians seem to believe this.While some passages seem to support this viewpoint other passages do not harmonize with this idea.Romans 2:11 supports that God does not show favoritism. Peter says God does not want anyone to perish but for all to come to repentance (2 Peter 3:9).If God: (1) does not want anyone to perish, (2) does not show favoritism, and (3) is just, loving and merciful, then it is irrational to believe he would predestine some to eternal torture in Hell and others to eternal joy in Heaven.
Omniscience, Omnipresence, and Omnipotent do not occur in Scripture, either in nominal or adjectival forms. However, many Christian communities have built rationales to support such concepts. Omniscience, a state of knowing all things; Omnipresence, a state of being always present; and Omnipotent, being all powerful have a potential to be incongruent (at odds) with each other and with God’s Justice, Love, and Mer